Gstz1 (NM_010363) Mouse Recombinant Protein

CAT#: TP502391

Purified recombinant protein of Mouse glutathione transferase zeta 1 (maleylacetoacetate isomerase) (Gstz1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR202391 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MQAGKPILYSYFRSSCSWRVRIALALKGIDYEIVPINLIKDGGQQFTEEFQTLNPMKQVPALKIDGITIV
  QSLAIMEYLEETRPIPRLLPQDPQKRAIVRMISDLIASGIQPLQNLSVLKQVGQENQMQWAQKVITSGFN
  ALEKILQSTAGKYCVGDEVSMADVCLVPQVANAERFKVDLSPYPTISHINKELLALEVFQVSHPRRQPDT
  PAELRT
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 24.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_034493
• Locus ID: 14874
• UniProt ID: Q9WVL0
• Cytogenetics: 12 D2
• Refseq Size: 1683
• Refseq ORF: 651
• Synonyms: MAAI
• Summary: Probable bifunctional enzyme showing minimal glutathione-conjugating activity with ethacrynic acid and 7-chloro-4-nitrobenz-2-oxa-1, 3-diazole and maleylacetoacetate isomerase activity. Has also low glutathione peroxidase activity with t-butyl and cumene hydroperoxides. Is able to catalyze the glutathione dependent oxygenation of dichloroacetic acid to glyoxylic acid (By similarity).[UniProtKB/Swiss-Prot Function]