Sike1 (NM_025679) Mouse Recombinant Protein

CAT#: TP502191

Purified recombinant protein of Mouse suppressor of IKBKE 1 (Sike1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR202191 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSCTIEKILTDAKTLLERLREHDAAAESLVDQSAALHRRVAAMREAGAVLPEQYQEDASDVKDMSKYKPH
  ILLSQENTQIRDLQQENRELWVSLEEHQDALELIMSKYRKQMLQLMVAKKAVDAEPVLKAHQSHSAEIES
  QIDRICEMGAVMRRAVQVDDNQFCKVQERLAQLELENKELRELLSISSESLQVGKESSVAPASQTIK
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 23.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_079955
• Locus ID: 66641
• UniProt ID: Q9CPR7
• Cytogenetics: 3 F2.2
• Refseq Size: 2798
• Refseq ORF: 624
• Synonyms: 2810005O12Rik; 5730470L24Rik; AI450236; AI839862; Sike; Sikeb
• Summary: Physiological suppressor of IKK-epsilon and TBK1 that plays an inhibitory role in virus- and TLR3-triggered IRF3. Inhibits TLR3-mediated activation of interferon-stimulated response elements (ISRE) and the IFN-beta promoter. May act by disrupting the interactions of IKBKE or TBK1 with TICAM1/TRIF, IRF3 and DDX58/RIG-I. Does not inhibit NF-kappa-B activation pathways (By similarity).[UniProtKB/Swiss-Prot Function]