Gfer (NM_023040) Mouse Recombinant Protein

CAT#: TP501982

Purified recombinant protein of Mouse growth factor, augmenter of liver regeneration (Gfer), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Images

Coomassie blue staining of purified Gfer protein (Cat# TP501982). The protein was produced from HEK293T cells transfected with Gfer cDNA clone (Cat# MR201982) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR201982 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAPSEPAGFPRGSRFSFLPGGARSEMTDDLVTDARGRGARHRDDTTPSAAPAPQGLEHGKRPCRACVDF
  KSWMRTQQKRDIKFREDCPQDREELGRHTWAFLHTLAAYYPDRPTPEQQQDMAQFIHIFSKFYPCEECAE
  DIRKRIGRNQPDTSTRVSFSQWLCRLHNEVNRKLGKPDFDCSRVDERWRDGWKDGSCD
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 22.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_075527
• Locus ID: 11692
• UniProt ID: P56213
• Cytogenetics: 17 12.48 cM
• Refseq Size: 1775
• Refseq ORF: 597
• Synonyms: Alr; ERV1
• Summary: FAD-dependent sulfhydryl oxidase that regenerates the redox-active disulfide bonds in CHCHD4/MIA40, a chaperone essential for disulfide bond formation and protein folding in the mitochondrial intermembrane space. The reduced form of CHCHD4/MIA40 forms a transient intermolecular disulfide bridge with GFER/ERV1, resulting in regeneration of the essential disulfide bonds in CHCHD4/MIA40, while GFER/ERV1 becomes re-oxidized by donating electrons to cytochrome c or molecular oxygen (By similarity).[UniProtKB/Swiss-Prot Function]