Kras (NM_021284) Mouse Recombinant Protein

CAT#: TP501779

Purified recombinant protein of Mouse Kirsten rat sarcoma viral oncogene homolog (Kras), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR201779 representing NM_021284
  Red=Cloning site Green=Tags(s)
  
  MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQ
  YMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQELARSYGIP
  FIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSRTRCTVM
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 21.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_067259
• Locus ID: 16653
• UniProt ID: P32883, Q5J7N1
• Cytogenetics: 6 77.37 cM
• Refseq Size: 4663
• Refseq ORF: 564
• Synonyms: AI929937; c-K-ras; c-Ki-ras; K-Ras; K-ras; Ki-ras; Kras-2; Kras2; p21B; ras
• Summary: Ras proteins bind GDP/GTP and possess intrinsic GTPase activity (By similarity). Plays an important role in the regulation of cell proliferation (PubMed:6474169, PubMed:1352876). Plays a role in promoting oncogenic events by inducing transcriptional silencing of tumor suppressor genes (TSGs) in colorectal cancer (CRC) cells in a ZNF304-dependent manner (By similarity).[UniProtKB/Swiss-Prot Function]