Cplx3 (NM_146223) Mouse Recombinant Protein

CAT#: TP501191

Purified recombinant protein of Mouse complexin 3 (Cplx3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR201191 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAFMVKSMVGGQLKNLTGSLGGGEDKGDGDKSAAEAQGMSREEYEEYQKQLVEEKMERDAQFTQRKAERA
  TLRSHFRDKYRLPKNETDESQIQLAGGDVELPRELAKMIEEDTEEEEDKASVLGQLASLPGLDLSSLKDK
  AQTTLGDLKQSAEKCHIM
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 17.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_666335
• Locus ID: 235415
• UniProt ID: Q8R1B5
• Cytogenetics: 9 B
• Refseq Size: 2859
• Refseq ORF: 477
• Synonyms: BC016632; CpxIII; ERGIC-53L; ERGL; Lamn1l; Lman1l
• Summary: Complexin that regulates SNARE protein complex-mediated synaptic vesicle fusion (PubMed:19386896). Required for the maintenance of synaptic ultrastructure in the adult retina (PubMed:19386896). Positively regulates synaptic transmission through synaptic vesicle availability and exocytosis of neurotransmitters at photoreceptor ribbon synapses in the retina (PubMed:15911881, PubMed:19386896, PubMed:27335398). Suppresses tonic photoreceptor activity and baseline 'noise' by suppression of Ca(2+) vesicle tonic release and the facilitation of evoked synchronous and asynchronous Ca(2+) vesicle release (PubMed:22694764, PubMed:27335398).[UniProtKB/Swiss-Prot Function]