C1d (NM_020558) Mouse Recombinant Protein
CAT#: TP500907
Purified recombinant protein of Mouse C1D nuclear receptor co-repressor (C1d), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Product Images
Frequently bought together (1)
Other products for "C1d"
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR200907 protein sequence
Red=Cloning site Green=Tags(s) MAGEEMNEDYPVEIHESLTALESSLGAVDDMLKTMMAVSRNELLQKLDPLEQAKVDLVSAYTLNSMFWVY LATQGVNPKEHPVKQELERIRVYMNRVKEITDKKKAAKLDRGAASRFVKNALWEPKAKSTPKVANKGKSK H myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 15.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_065583 |
Locus ID | 57316 |
UniProt ID | O35473 |
Cytogenetics | 11 A2 |
Refseq Size | 2957 |
Refseq ORF | 426 |
Synonyms | 1110036E10Rik; AI875855; SUN-CoR |
Summary | Plays a role in the recruitment of the RNA exosome complex to pre-rRNA to mediate the 3'-5' end processing of the 5.8S rRNA; this function may include MPHOSPH6. Can activate PRKDC not only in the presence of linear DNA but also in the presence of supercoiled DNA. Can induce apoptosis in a p53/TP53 dependent manner. May regulate the TRAX/TSN complex formation. Potentiates transcriptional repression by NR1D1 and THRB (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.