Nutf2 (NM_026532) Mouse Recombinant Protein

CAT#: TP500677

Purified recombinant protein of Mouse nuclear transport factor 2 (Nutf2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR200677 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGDKPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITA
  QDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 14.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_080808
• Locus ID: 68051
• UniProt ID: P61971
• Cytogenetics: 8 53.05 cM
• Refseq Size: 1966
• Refseq ORF: 384
• Synonyms: 2700067I02Rik; AI115459; AI413596; AW546000; Ntf2; Ntf3; PP15
• Summary: Mediates the import of GDP-bound RAN from the cytoplasm into the nucleus which is essential for the function of RAN in cargo receptor-mediated nucleocytoplasmic transport. Thereby, plays indirectly a more general role in cargo receptor-mediated nucleocytoplasmic transport. Interacts with GDP-bound RAN in the cytosol, recruits it to the nuclear pore complex via its interaction with nucleoporins and promotes its nuclear import.[UniProtKB/Swiss-Prot Function]