Sst (NM_009215) Mouse Recombinant Protein

CAT#: TP500492

Purified recombinant protein of Mouse somatostatin (Sst), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR200492 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLSCRLQCALAALCIVLALGGVTGAPSDPRLRQFLQKSLAAATGKQELAKYFLAELLSEPNQTENDALEP
  EDLPQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 12.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_033241
• Locus ID: 20604
• UniProt ID: P60041, Q545V6
• Cytogenetics: 16 15.0 cM
• Refseq Size: 599
• Refseq ORF: 351
• Synonyms: Smst; SOM; SRIF; SS
• Summary: Somatostatin-14: Inhibits the secretion of pituitary hormones, including that of growth hormone/somatotropin (GH1), PRL, ACTH, luteinizing hormone (LH) and TSH. Also impairs ghrelin- and GnRH-stimulated secretion of GH1 and LH; the inhibition of ghrelin-stimulated secretion of GH1 can be further increased by neuronostatin.[UniProtKB/Swiss-Prot Function]