1810020G14Rik (BC005675) Mouse Recombinant Protein

CAT#: TP500115

Purified recombinant protein of Mouse RIKEN cDNA 1810020G14 gene (cDNA clone MGC:11762 IMAGE:3153356), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR200115 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MIAPAVLRALRKNKTLRYGVPMLLLVVGGSFGLREFSQIRYDAVTIKIDPELEKKLKVNKITLESEYERL
  LCLLCRQ
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 8.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• Locus ID: 66272
• UniProt ID: Q9CR63
• Cytogenetics: 12 D1
• Refseq Size: 639
• Refseq ORF: 231
• Synonyms: 1810020G14Rik; 1810055I05Rik; BB388670
• Summary: Required for the assembly of the mitochondrial respiratory chain complex IV (CIV), also known as cytochrome c oxidase. Promotes the insertion of copper into the active site of cytochrome c oxidase subunit II (MT-CO2/COX2). Interacts specifically with newly synthesized MT-CO2/COX and its copper center-forming metallochaperones SCO1, SCO2 and COA6. Probably facilitates MT-CO2/COX2 association with the MITRAC assembly intermediate containing MT-CO1/COX1, thereby participating in merging the MT-CO1/COX1 and MT-CO2/COX2 assembly lines.[UniProtKB/Swiss-Prot Function]