Fxyd3 (BC051033) Mouse Recombinant Protein

CAT#: TP500072

Purified recombinant protein of Mouse FXYD domain-containing ion transport regulator 3 (cDNA clone MGC:54741 IMAGE:4460667), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR200072 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MQEVVLSLLVLLAGLPTLDANDPENKNDPFYYDWYSLRVGGLICAGILCALGIIVLMSGKCKCKFRQKPR
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 7.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• Locus ID: 17178
• UniProt ID: Q61835
• Cytogenetics: 7 B1
• Refseq Size: 989
• Refseq ORF: 210
• Synonyms: Mat8
• Summary: This gene encodes a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The encoded protein is a transmembrane protein that functions as a specific regulator of Na,K-ATPase. [provided by RefSeq, Aug 2009]