PLGF (PGF) (NM_001207012) Human Recombinant Protein

CAT#: TP333309

Purified recombinant protein of Homo sapiens placental growth factor (PGF), transcript variant 2, full length, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20 µg

Product Images

Purified recombinant protein PGF was analyzed by SDS-PAGE gel and Coomossie Blue Staining.

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC233309 protein sequence
  Red=Cloning site Green=Tags(s)
  
  XCRS*GCSLASCSSWPGWRCLLCPPSSGPCLLGTARQRWKWYPSRKCGAAATAGRWRGWWTSCPSTPARW
  STCSAHPVSPCCAAPAAAAMRICTVCRWRRPMSPCSS*RSVLGTGPPTWS*RSLSTFAANAGLCGRR*SR
  KGAAMLFPG
  
  myc-FLAG tag
• Tag: Myc-DDK
• Predicted MW: 16.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate Bradford method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001193941
• Locus ID: 5228
• UniProt ID: P49763, Q86TW6
• Cytogenetics: 14q24.3
• Refseq Size: 1848
• Refseq ORF: 447
• Synonyms: D12S1900; PGFL; PIGF; PLGF; PlGF-2; SHGC-10760
• Summary: This gene encodes a growth factor found in placenta which is homologous to vascular endothelial growth factor. Alternatively spliced transcripts encoding different isoforms have been found for this gene.[provided by RefSeq, Jun 2011]
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Bladder cancer, Focal adhesion, mTOR signaling pathway, Pancreatic cancer, Pathways in cancer, Renal cell carcinoma