CELF3 (NM_001172649) Human Recombinant Protein

CAT#: TP330039L

Purified recombinant protein of Homo sapiens CUGBP, Elav-like family member 3 (CELF3), transcript variant 3, 1 mg

Product Images

Coomassie blue staining of purified CELF3 protein (Cat# TP330039). The protein was produced from HEK293T cells transfected with CELF3 cDNA clone (Cat# RC230039) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC230039 representing NM_001172649
  Red=Cloning site Green=Tags(s)
  
  MKEPDAIKLFVGQIPRHLEEKDLKPIFEQFGRIFELTVIKDKYTGLHKGCAFLTYCARDSALKAQSALHE
  QKTLPGMNRPIQVKPADSESRGEDRKLFVGMLGKQQTDEDVRKMFEPFGTIDECTVLRGPDGTSKGCAFV
  KFQTHAEAQAAINTLHSSRTLPGASSSLVVKFADTEKERGLRRMQQVATQLGMFSPIALQFGAYSAYTQA
  LMQQQAALVAAHSAYLSPMATMAAVQMQHMAAINANGLIATPITPSSAQSPAAPVDPLQQAYAGMQHYTA
  AYPAAYSLVAPAFPQPPALVAQQPPPPPQQQQQQQQQQQQQQQREGPDGCNIFIYHLPQEFTDSEILQMF
  VPFGHVISAKVFVDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPKDANRPY
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 46.1
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001166120
• Locus ID: 11189
• UniProt ID: Q5SZQ8
• Cytogenetics: 1q21.3
• Refseq ORF: 1245
• Synonyms: BRUNOL1; CAGH4; ERDA4; ETR-1; TNRC4
• Summary: Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. Multiple alternatively spliced transcript variants encoding different isoforms have been identified in this gene. [provided by RefSeq, Feb 2010]
• Protein Families: Transcription Factors