FAM229A (NM_001167676) Human Recombinant Protein

CAT#: TP329555

Recombinant protein of human hypothetical LOC100128071 (LOC100128071), 20 µg

Product Images

Coomassie blue staining of purified FAM229A protein (Cat# TP329555). The protein was produced from HEK293T cells transfected with FAM229A cDNA clone (Cat# RC229555) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC229555 representing NM_001167676
  Red=Cloning site Green=Tags(s)
  
  MLPSSTPGPGHATETCPAPPGPERSPAARAPAAASSLGPVSTAGRAPRGLDMSAQEPPQGRRFPIEAGDS
  RGLAAAPESQDSPEAVATEHNPVRPLRRCPGCHCLTLLHVPIDVYLAMGGSPRARAT
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 13.4
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001161148
• Locus ID: 100128071
• UniProt ID: H3BQW9
• Cytogenetics: 1p35.1
• Refseq ORF: 381