C9orf140 (SAPCD2) (NM_178448) Human Recombinant Protein

CAT#: TP329187L

Recombinant protein of human chromosome 9 open reading frame 140 (C9orf140), expressed in human cells, 20 µg, 1 mg

Product Images

Coomassie blue staining of purified SAPCD2 protein (Cat# TP329187). The protein was produced from HEK293T cells transfected with SAPCD2 cDNA clone (Cat# RC229187) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC229187 representing NM_178448
  Red=Cloning site Green=Tags(s)
  
  MAERGRVPPPAPAPSTEGLPRAFLQSLRTLFDILDDRRRGCVHLREIESRWQGTDARELPRGVLEGLRQV
  APASGYLTFERFVAGLRTSLLSADGGPRDPTRAPARPGDQPPPPPQRLVFAPADEPRTVLERKPLPLGVR
  APLAGPSAAARSPEQLCAPAEAAPCPAEPERSQSAALEPSSSADAGAVACRALEADSGDARRAPRARGER
  RRHTIASGVDCGLLKQMKELEQEKEVLLQGLEMMARGRDWYQQQLQRVQERQRRLGQSRASADFGAAGSP
  RPLGRLLPKVQEVARCLGELLAAACASRALPPSSSGPPCPALTSTSPPVWQQQTILMLKEQNRLLTQEVT
  EKSERITQLEQEKSALIKQLFEARALSQQDGGPLDSTFI
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 42.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: C9orf140
• Locus ID: 89958
• UniProt ID: Q86UD0
• Cytogenetics: 9q34.3
• Refseq ORF: 1167
• Synonyms: C9orf140; p42.3
• Summary: Plays a role in planar mitotic spindle orientation in retinal progenitor cells (RPCs) and promotes the production of symmetric terminal divisions (By similarity). Negatively regulates the mitotic apical cortex localization of GPSM2 (PubMed:26766442). Involved also in positive regulation of cell proliferation and tumor cell growth (PubMed:23576022, PubMed:23704824).[UniProtKB/Swiss-Prot Function]