SYT2 (NM_001136504) Human Recombinant Protein
CAT#: TP326544
Recombinant protein of human synaptotagmin II (SYT2), transcript variant 2, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC226544 protein sequence
Red=Cloning site Green=Tags(s) MRNIFKRNQEPIVAPATTTATMPIGPVDNSTESGGAGESQEDMFAKLKEKLFNEINKIPLPPWALIAIAV VAGLLLLTCCFCICKKCCCKKKKNKKEKGKGMKNAMNMKDMKGGQDDDDAETGLTEGEGEGEEEKEPENL GKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPAFNETFTF KVPYQELGGKTLVMAIYDFDRFSKHDIIGEVKVPMNTVDLGQPIEEWRDLQGGEKEEPEKLGDICTSLRY VPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQI QKVQVVVTVLDYDKLGKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSLKPEEEVDALLGKNK TRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 46.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001129976 |
Locus ID | 127833 |
UniProt ID | Q8N9I0 |
Cytogenetics | 1q32.1 |
Refseq Size | 7614 |
Refseq ORF | 1257 |
Synonyms | CMS7; MYSPC; SytII |
Summary | This gene encodes a synaptic vesicle membrane protein. The encoded protein is thought to function as a calcium sensor in vesicular trafficking and exocytosis. Mutations in this gene are associated with myasthenic syndrome, presynaptic, congenital, with or without motor neuropathy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2014] |
Protein Families | Secreted Protein, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406152 | SYT2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC427901 | SYT2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY406152 | Transient overexpression lysate of synaptotagmin II (SYT2), transcript variant 1 |
USD 665.00 |
|
LY427901 | Transient overexpression lysate of synaptotagmin II (SYT2), transcript variant 2 |
USD 436.00 |
|
PH326544 | SYT2 MS Standard C13 and N15-labeled recombinant protein (NP_001129976) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review