C7orf50 (NM_001134395) Human Recombinant Protein
CAT#: TP325215
Purified recombinant protein of Homo sapiens chromosome 7 open reading frame 50 (C7orf50), transcript variant 2, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC225215 protein sequence
Red=Cloning site Green=Tags(s) MAKQKRKVPEVTEKKNKKLKKASAEGPLLGPEAAPSGEGAGSKGEAVLRPGLDAEPELSPEEQRVLERKL KKERKKEERQRLREAGLVAQHPPARRSGAELALDYLCRWAQKHKNWRFQKTRQTWLLLHMYDSDKVPDEH FSTLLAYLEGLQGRARELTVQKAEALMRELDEEGSDPPLPGRAQRIRQVLQLLS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 21.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001127867 |
Locus ID | 84310 |
UniProt ID | Q9BRJ6 |
Cytogenetics | 7p22.3 |
Refseq Size | 1301 |
Refseq ORF | 582 |
Synonyms | YCR016W |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410187 | C7orf50 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC427414 | C7orf50 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC427415 | C7orf50 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY410187 | Transient overexpression lysate of chromosome 7 open reading frame 50 (C7orf50), transcript variant 1 |
USD 436.00 |
|
LY427414 | Transient overexpression lysate of chromosome 7 open reading frame 50 (C7orf50), transcript variant 2 |
USD 436.00 |
|
LY427415 | Transient overexpression lysate of chromosome 7 open reading frame 50 (C7orf50), transcript variant 3 |
USD 436.00 |
|
PH302632 | C7orf50 MS Standard C13 and N15-labeled recombinant protein (NP_115726) |
USD 3,255.00 |
|
PH325215 | C7orf50 MS Standard C13 and N15-labeled recombinant protein (NP_001127867) |
USD 3,255.00 |
|
PH325216 | C7orf50 MS Standard C13 and N15-labeled recombinant protein (NP_001127868) |
USD 3,255.00 |
|
TP302632 | Recombinant protein of human chromosome 7 open reading frame 50 (C7orf50), transcript variant 1, 20 µg |
USD 867.00 |
|
TP325216 | Recombinant protein of human chromosome 7 open reading frame 50 (C7orf50), transcript variant 3, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review