IGFL2 (NM_001135113) Human Recombinant Protein

CAT#: TP325054M

Purified recombinant protein of Human IGF-like family member 2 (IGFL2), transcript variant 2,full length， with C-terminal MYC/DDK tag, expressed in HEK293T cells, 100 µg

Product Images

Purified recombinant protein IGFL2 was analyzed by SDS-PAGE gel and Coomossie Blue Staining.

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC225054 representing NM_001135113
  Red=Cloning site Green=Tags(s)
  
  MVPRIFAPAYVSVCLLLLCPREVIAPAGSEPWLCQPAPRCGDKIYNPLEQCCYNDAIVSLSETRQCGPPC
  TFWPCFELCCLDSFGLTNDFVVKLKVQGVNSQCHSSPISSKCESRRRFP
  
  myc-FLAG tag
• Tag: Myc-DDK
• Predicted MW: 13.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate Bradford method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product when appropriate storage and handling conditions are followed. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001128585
• Locus ID: 147920
• UniProt ID: Q6UWQ7
• Cytogenetics: 19q13.32
• Refseq ORF: 357
• Synonyms: UNQ645; VPRI645
• Summary: IGFL2 belongs to the insulin-like growth factor (IGF; see MIM 147440) family of signaling molecules that play critical roles in cellular energy metabolism and in growth and development, especially prenatal growth (Emtage et al., 2006 [PubMed 16890402]).[supplied by OMIM, Mar 2008]
• Protein Families: Secreted Protein