IGFL2 (NM_001135113) Human Recombinant Protein
CAT#: TP325054M
Purified recombinant protein of Human IGF-like family member 2 (IGFL2), transcript variant 2,full length, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 100 µg
Frequently bought together (2)
Other products for "IGFL2"
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC225054 representing NM_001135113
Red=Cloning site Green=Tags(s) MVPRIFAPAYVSVCLLLLCPREVIAPAGSEPWLCQPAPRCGDKIYNPLEQCCYNDAIVSLSETRQCGPPC TFWPCFELCCLDSFGLTNDFVVKLKVQGVNSQCHSSPISSKCESRRRFP myc-FLAG tag |
Tag | Myc-DDK |
Predicted MW | 13.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate Bradford method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product when appropriate storage and handling conditions are followed. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001128585 |
Locus ID | 147920 |
UniProt ID | Q6UWQ7 |
Cytogenetics | 19q13.32 |
Refseq ORF | 357 |
Synonyms | UNQ645; VPRI645 |
Summary | IGFL2 belongs to the insulin-like growth factor (IGF; see MIM 147440) family of signaling molecules that play critical roles in cellular energy metabolism and in growth and development, especially prenatal growth (Emtage et al., 2006 [PubMed 16890402]).[supplied by OMIM, Mar 2008] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.