OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

IGFL2 (NM_001135113) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP325054M
Purified recombinant protein of Human IGF-like family member 2 (IGFL2), transcript variant 2,full length, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 100 µg
Size:
100 ug 20 ug 1 mg
  $2,950.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA332341 Rabbit Polyclonal Anti-IGFL2 Antibody
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "IGFL2 or NM_001135113"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC225054 representing NM_001135113
Red=Cloning site Green=Tags(s)

MVPRIFAPAYVSVCLLLLCPREVIAPAGSEPWLCQPAPRCGDKIYNPLEQCCYNDAIVSLSETRQCGPPC
TFWPCFELCCLDSFGLTNDFVVKLKVQGVNSQCHSSPISSKCESRRRFP

myc-FLAG tag
Tag Myc-DDK
Predicted MW 13.1 kDa
Concentration >0.05 µg/µL as determined by microplate Bradford method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product when appropriate storage and handling conditions are followed. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001128585
Locus ID 147920
UniProt ID Q6UWQ7
Cytogenetics 19q13.32
RefSeq ORF 357
Synonyms UNQ645; VPRI645
Summary IGFL2 belongs to the insulin-like growth factor (IGF; see MIM 147440) family of signaling molecules that play critical roles in cellular energy metabolism and in growth and development, especially prenatal growth (Emtage et al., 2006 PubMed 16890402).supplied by OMIM, Mar 2008
Protein Categories Growth Factors, Intracellular Proteins, Secreated Proteins
Protein Families Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products