SSX4 (NM_005636) Human Recombinant Protein

CAT#: TP324314

Recombinant protein of human synovial sarcoma, X breakpoint 4 (SSX4), transcript variant 1, 20 µg

Product Images

Coomassie blue staining of purified SSX4 protein (Cat# TP324314). The protein was produced from HEK293T cells transfected with SSX4 cDNA clone (Cat# RC224314) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC224314 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNGDDAFARRPRDDAQISEKLRKAFDDIAKYFSKKEWEKMKSSEKIVYVYMKLNYEVMTKLGFKVTLPPF
  MRSKRAADFHGNDFGNDRNHRNQVERPQMTFGSLQRIFPKIMPKKPAEEENGLKEVPEASGPQNDGKQLC
  PPGNPSTLEKINKTSGPKRGKHAWTHRLRERKQLVVYEEISDPEEDDE
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 21.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_005627
• Locus ID: 6759
• UniProt ID: O60224
• Cytogenetics: Xp11.23
• Refseq Size: 1250
• Refseq ORF: 564
• Synonyms: CT5.4
• Summary: The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneously humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. SSX1, SSX2 and SSX4 genes have been involved in the t(X;18) translocation characteristically found in all synovial sarcomas. This translocation results in the fusion of the synovial sarcoma translocation gene on chromosome 18 to one of the SSX genes on chromosome X. Chromosome Xp11 contains a segmental duplication resulting in two identical copies of synovial sarcoma, X breakpoint 4, SSX4 and SSX4B, in tail-to-tail orientation. This gene, SSX4, represents the more telomeric copy. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]
• Protein Families: Transcription Factors