AKAP7 (NM_138633) Human Recombinant Protein

CAT#: TP323812L

Recombinant protein of human A kinase (PRKA) anchor protein 7 (AKAP7), transcript variant beta, 1 mg

Product Images

Coomassie blue staining of purified AKAP7 protein (Cat# TP323812). The protein was produced from HEK293T cells transfected with AKAP7 cDNA clone (Cat# RC223812) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC223812 representing NM_138633
  Red=Cloning site Green=Tags(s)
  
  MGQLCCFPFSRDEGKISELESSSSAVLQRYSKDIPSWSSGEKNGGEPDDAELVRLSKRLVENAVLKAVQQ
  YLEETQNKNKPGEGSSVKTEAADQNGNDNENNRK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 11.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_619539
• Locus ID: 9465
• UniProt ID: O43687, Q2TAJ5
• Cytogenetics: 6q23.2
• Refseq Size: 2348
• Refseq ORF: 312
• Synonyms: AKAP15; AKAP18
• Summary: This gene encodes a member of the A-kinase anchoring protein (AKAP) family, a group of functionally related proteins that bind to a regulatory subunit (RII) of cAMP-dependent protein kinase A (PKA) and target the enzyme to specific subcellular compartments. AKAPs have a common RII-binding domain, but contain different targeting motifs responsible for directing PKA to distinct intracellular locations. Three alternatively spliced transcript variants encoding different isoforms have been described.[provided by RefSeq, Apr 2011]
• Protein Families: Druggable Genome