PEAMT (PEMT) (NM_007169) Human Recombinant Protein
CAT#: TP323190
Recombinant protein of human phosphatidylethanolamine N-methyltransferase (PEMT), nuclear gene encoding mitochondrial protein, transcript variant 2, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC223190 representing NM_007169
Red=Cloning site Green=Tags(s) MTRLLGYVDPLDPSFVAAVITITFNPLYWNVVARWEHKTRKLSRAFGSPYLACYSLSVTILLLNFLRSHC FTQAMLSQPRMESLDTPAAYSLGLALLGLGVVLVLSSFFALGFAGTFLGDYFGILKEARVTVFPFNILDN PMYWGSTANYLGWAIMHASPTGLLLTVLVALTYIVALLYEEPFTAEIYRQKASGSHKRS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_009100 |
Locus ID | 10400 |
UniProt ID | Q9UBM1 |
Cytogenetics | 17p11.2 |
Refseq Size | 1008 |
Refseq ORF | 597 |
Synonyms | PEAMT; PEMPT; PEMT2; PLMT; PNMT |
Summary | Phosphatidylcholine (PC) is the most abundant mammalian phospholipid. This gene encodes an enzyme which converts phosphatidylethanolamine to phosphatidylcholine by sequential methylation in the liver. Another distinct synthetic pathway in nucleated cells converts intracellular choline to phosphatidylcholine by a three-step process. The protein isoforms encoded by this gene localize to the endoplasmic reticulum and mitochondria-associated membranes. Alternate splicing of this gene results in multiple transcript variants encoding different isoforms. [provided by RefSeq, May 2012] |
Protein Families | Transmembrane |
Protein Pathways | Glycerophospholipid metabolism, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402097 | PEMT HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC407769 | PEMT HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC407770 | PEMT HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY402097 | Transient overexpression lysate of phosphatidylethanolamine N-methyltransferase (PEMT), nuclear gene encoding mitochondrial protein, transcript variant 2 |
USD 436.00 |
|
LY407769 | Transient overexpression lysate of phosphatidylethanolamine N-methyltransferase (PEMT), nuclear gene encoding mitochondrial protein, transcript variant 1 |
USD 436.00 |
|
LY407770 | Transient overexpression lysate of phosphatidylethanolamine N-methyltransferase (PEMT), nuclear gene encoding mitochondrial protein, transcript variant 3 |
USD 436.00 |
|
PH323190 | PEMT MS Standard C13 and N15-labeled recombinant protein (NP_009100) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review