MHF1 (CENPS) (NM_199295) Human Recombinant Protein

CAT#: TP322556

Recombinant protein of human apoptosis-inducing, TAF9-like domain 1 (APITD1), transcript variant B, 20 µg

Product Images

Coomassie blue staining of purified APITD1 protein (Cat# TP322556). The protein was produced from HEK293T cells transfected with APITD1 cDNA clone (Cat# [RC222556]) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC222556 representing NM_199295
  Red=Cloning site Green=Tags(s)
  
  MEEEAETEEQQRFSYQQRLKAAVHYTVGCLCEEVALDKEMQFSKQTIAAISELTFRQCENFAKDLEMFAR
  HAKRTTINTEDVKLLARRSNSLLKYITDKSEEIAQINLERKAQKKKKSEDGSKNSRQPAEAGVVESEN
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 11.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_954992
• Locus ID: 378708
• UniProt ID: Q8N2Z9
• Cytogenetics: 1p36.22
• Refseq Size: 1443
• Refseq ORF: 300
• Synonyms: apoptosis-inducing, TAF9-like domain 1; CENP-S; CENPS; centromere protein S; MGC32686; OTTHUMP00000065118; OTTHUMP00000065119
• Summary: This gene was identified in the neuroblastoma tumor suppressor candidate region on chromosome 1p36. It contains a TFIID-31 domain, similar to that found in TATA box-binding protein-associated factor, TAF(II)31, which is required for p53-mediated transcription activation. This gene was expressed at very low levels in neuroblastoma tumors, and was shown to reduce cell growth in neuroblastoma cells, suggesting that it may have a role in a cell death pathway. The protein is a component of multiple complexes, including the Fanconi anemia (FA) core complex, the APITD1/CENPS complex, and the CENPA-CAD (nucleosome distal) complex. Known functions include an involvement with chromatin associations of the FA core complex, and a role in the stable assembly of the outer kinetochore. Alternative splicing of this gene results in multiple transcript variants. Naturally occurring read-through transcripts also exist between this gene and the downstream cortistatin (CORT) gene, as represented in GeneID:100526739. An APITD1-related pseudogene has been identified on chromosome 7. [provided by RefSeq, Nov 2010]