MMP24 (NM_006690) Human Recombinant Protein

CAT#: TP322100

Recombinant protein of human matrix metallopeptidase 24 (membrane-inserted) (MMP24), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20 μg

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC222100 representing NM_006690
  Red=Cloning site Green=Tags(s)
  
  MPRSRGGRAAPGPPPPPPPPGQAPRWSRWRVPGRLLLLLLPALCCLPGAARAAAAAAGAGNRAAVAVAVA
  RADEAEAPFAGQNWLKSYGYLLPYDSRASALHSAKALQSAVSTMQQFYGIPVTGVLDQTTIEWMKKPRCG
  VPDHPHLSRRRRNKRYALTGQKWRQKHITYSIHNYTPKVGELDTRKAIRQAFDVWQKVTPLTFEEVPYHE
  IKSDRKEADIMIFFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNANHDGNDLFLVA
  VHELGHALGLEHSSDPSAIMAPFYQYMETHNFKLPQDDLQGIQKIYGPPAEPLEPTRPLPTLPVRRIHSP
  SERKHERQPRPPRPPLGDRPSTPGTKPNICDGNFNTVALFRGEMFVFKDRWFWRLRNNRVQEGYPMQIEQ
  FWKGLPARIDAAYERADGRFVFFKGDKYWVFKEVTVEPGYPHSLGELGSCLPREGIDTALRWEPVGKTYF
  FKGERYWRYSEERRATDPGYPKPITVWKGIPQAPQGAFISKEGYYTYFYKGRDYWKFDNQKLSVEPGYPR
  NILRDWMGCNQKEVERRKERRLPQDDVDIMVTINDVPGSVNAVAVVIPCILSLCILVLVYTIFQFKNKTG
  PQPVTYYKRPVQEWV
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 73.2 kDa
• Concentration: >0.05 ug/uL as determined by Bradford protein assay method.
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 100 mM Glycine, pH 3.5, 10% Glycerol
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_006681.1
• Locus ID: 10893
• UniProt ID: Q9Y5R2, Q86VV6
• Cytogenetics: 20q11.22
• Refseq Size: 4344
• Refseq ORF: 1935
• Synonyms: MMP-24; MMP25; MT-MMP 5; MT-MMP5; MT5-MMP; MT5MMP; MTMMP5
• Summary: This gene encodes a member of the peptidase M10 family of matrix metalloproteinases (MMPs). Proteins in this family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. The encoded preproprotein is proteolytically processed to generate the mature protease. Unlike most MMPs, which are secreted, this protease is a member of the membrane-type MMP (MT-MMP) subfamily, contains a transmembrane domain and is expressed at the cell surface. Substrates of this protease include the proteins cadherin 2 and matrix metallopeptidase 2 (also known as 72 kDa type IV collagenase). The gene has previously been referred to as MMP25 but has been renamed matrix metallopeptidase 24 (MMP24). [provided by RefSeq, Oct 2019]
• Protein Families: Druggable Genome, Transmembrane