DLGAP4 (NM_001042486) Human Recombinant Protein

CAT#: TP321038

Recombinant protein of human discs, large (Drosophila) homolog-associated protein 4 (DLGAP4), transcript variant 3, 20 µg

Product Images

Coomassie blue staining of purified DLGAP4 protein (Cat# TP321038). The protein was produced from HEK293T cells transfected with DLGAP4 cDNA clone (Cat# RC221038) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC221038 representing NM_001042486
  Red=Cloning site Green=Tags(s)
  
  MSSRRDTDSDTQDANDSSCKSSERSLPDCTPHPNSISIDAGPRQAPKIAQIKRNLSYGDNSDPALEASSL
  PPPDPWLETSSSSPAEPAQPGACRRDGYWFLKLLQAETERLEGWCCQMDKETKENNLSEEVLGKVLSAVG
  SAQLLMSQKFQQFRGLCEQNLNPDANPRPTAQDLAGFWDLLQLSIEDISMKFDELYHLKANSWQLVETPE
  KRKEEKKPPPPVPKKPAKSKPAVSRDKASDASDKQRQEARKRLLAAKRAASVRQNSATESADSIEIYVPE
  AQTRL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 31.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001035951
• Locus ID: 22839
• UniProt ID: Q9Y2H0, A0A0B4J2C2
• Cytogenetics: 20q11.23
• Refseq Size: 2982
• Refseq ORF: 855
• Synonyms: DAP-4; DAP4; DLP4; SAPAP-4; SAPAP4
• Summary: The product of this gene is a membrane-associated guanylate kinase found at the postsynaptic density in neuronal cells. It is a signaling molecule that can interact with potassium channels and receptors, as well as other signaling molecules. The protein encoded by this gene can interact with PSD-95 through its guanylate kinase domain and may be involved in clustering PSD-95 in the postsynaptic density region. The encoded protein is one of at least four similar proteins that have been found. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]