HOXA7 (NM_006896) Human Recombinant Protein

CAT#: TP320703L

Recombinant protein of human homeobox A7 (HOXA7), 1 mg

Product Images

Coomassie blue staining of purified HOXA7 protein (Cat# TP320703). The protein was produced from HEK293T cells transfected with HOXA7 cDNA clone (Cat# RC220703) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC220703 representing NM_006896
  Red=Cloning site Green=Tags(s)
  
  MSSSYYVNALFSKYTAGASLFQNAEPTSCSFAPNSQRSGYGAGAGAFASTVPGLYNVNSPLYQSPFASGY
  GLGADAYGNLPCASYDQNIPGLCSDLAKGACDKTDEGALHGAAEANFRIYPWMRSSGPDRKRGRQTYTRY
  QTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKDEGPTAAAAPEGAVPSAAAT
  AAADKADEEDDDEEEEDEEE
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 25.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_008827
• Locus ID: 3204
• UniProt ID: P31268
• Cytogenetics: 7p15.2
• Refseq Size: 2018
• Refseq ORF: 690
• Synonyms: ANTP; HOX1; HOX1.1; HOX1A
• Summary: In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. For example, the encoded protein represses the transcription of differentiation-specific genes during keratinocyte proliferation, but this repression is then overcome by differentiation signals. This gene is highly similar to the antennapedia (Antp) gene of Drosophila. [provided by RefSeq, Jul 2008]
• Protein Families: Transcription Factors