UQCRHL (NM_001089591) Human Recombinant Protein

CAT#: TP319881M

Recombinant protein of human ubiquinol-cytochrome c reductase hinge protein-like (UQCRHL), 100 µg

Product Images

Coomassie blue staining of purified UQCRHL protein (Cat# TP319881). The protein was produced from HEK293T cells transfected with UQCRHL cDNA clone (Cat# RC219881) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC219881 representing NM_001089591
  Red=Cloning site Green=Tags(s)
  
  MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELYDEHVSSRSHTEEDCTEE
  LFDFLHAKDHCVAHKLFNNLK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 10.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001083060
• Locus ID: 440567
• UniProt ID: A0A096LP55
• Cytogenetics: 1p36.21
• Refseq Size: 538
• Refseq ORF: 273
• Summary: This gene has characteristics of a pseudogene derived from the UQCRH gene. However, there is still an open reading frame that could produce a protein of the same or nearly the same size as that of the UQCRH gene, so this gene is being called protein-coding for now. [provided by RefSeq, Jul 2008]
• Protein Pathways: Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease