HVCN1 (NM_032369) Human Recombinant Protein

CAT#: TP319422

Recombinant protein of human hydrogen voltage-gated channel 1 (HVCN1), transcript variant 2, 20 µg

Product Images

Coomassie blue staining of purified HVCN1 protein (Cat# TP319422). The protein was produced from HEK293T cells transfected with HVCN1 cDNA clone (Cat# RC219422) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC219422 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MATWDEKAVTRRAKVAPAERMSKFLRHFTVVGDDYHAWNINYKKWENEEEEEEEEQPPPTPVSGEEGRAA
  APDVAPAPGPAPRAPLDFRGMLRKLFSSHRFQVIIICLVVLDALLVLAELILDLKIIQPDKNNYAAMVFH
  YMSITILVFFMMEIIFKLFVFRLEFFHHKFEILDAVVVVVSFILDIVLLFQEHQFEALGLLILLRLWRVA
  RIINGIIISVKTRSERQLLRLKQMNVQLAAKIQHLEFSCSEKEQEIERLNKLLRQHGLLGEVN
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 31.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_115745
• Locus ID: 84329
• UniProt ID: Q96D96
• Cytogenetics: 12q24.11
• Refseq Size: 1727
• Refseq ORF: 819
• Synonyms: HV1; VSOP
• Summary: This gene encodes a voltage-gated protein channel protein expressed more highly in certain cells of the immune system. Phagocytic cells produce superoxide anions which require this channel protein, and in B cells this same process facilitates antibody production. This same channel protein, however, can also regulate functions in other cells including spermatozoa. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2012]
• Protein Families: Druggable Genome, Transmembrane