HSPA14 (NM_016299) Human Recombinant Protein

CAT#: TP318858

Recombinant protein of human heat shock 70kDa protein 14 (HSPA14), transcript variant 1, 20 µg

Product Images

Coomassie blue staining of purified HSPA14 protein (Cat# TP318858). The protein was produced from HEK293T cells transfected with HSPA14 cDNA clone (Cat# RC218858) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC218858 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAIGVHLGCTSACVAVYKDGRAGVVANDAGDRVTPAVVAYSENEEIVGLAAKQSRIRNISNTVMKVKQI
  LGRSSSDPQAQKYIAESKCLVIEKNGKLRYEIDTGEETKFVNPEDVARLIFSKMKETAHSVLGSDANDVV
  ITVPFDFGEKQKNALGEAARAAGFNVLRLIHEPSAALLAYGIGQDSPTGKSNILVFKLGGTSLSLSVMEV
  NSGIYRVLSTNTDDNIGGAHFTETLAQYLASEFQRSFKHDVRGNARAMMKLTNSAEVAKHSLSTLGSANC
  FLDSLYEGQDFDCNVSRARFELLCSPLFNKCIEAIRGLLDQNGFTADDINKVVLCGGSSRIPKLQQLIKD
  LFPAVELLNSIPPDEVIPIGAAIEAGILIGKENLLVEDSLMIECSARDILVKGVDESGASRFTVLFPSGT
  PLPARRQHTLQAPGSISSVCLELYESDGKNSAKEETKFAQVVLQDLDKKENGLRDILAVLTMKRDGSLHV
  TCTDQETGKCEAISIEIAS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 54.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_057383
• Locus ID: 51182
• UniProt ID: Q0VDF9
• Cytogenetics: 10p13
• Refseq Size: 1921
• Refseq ORF: 1527
• Synonyms: HSP70-4; HSP70L1
• Summary: Component of the ribosome-associated complex (RAC), a complex involved in folding or maintaining nascent polypeptides in a folding-competent state. In the RAC complex, binds to the nascent polypeptide chain, while DNAJC2 stimulates its ATPase activity.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome, Stem cell - Pluripotency