SNRPC (NM_003093) Human Recombinant Protein

CAT#: TP318418M

Recombinant protein of human small nuclear ribonucleoprotein polypeptide C (SNRPC), 100 µg

Product Images

Coomassie blue staining of purified SNRPC protein (Cat# TP318418). The protein was produced from HEK293T cells transfected with SNRPC cDNA clone (Cat# RC218418) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC218418 representing NM_003093
  Red=Cloning site Green=Tags(s)
  
  MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLIDKTTAAFQQGKIPPTPFSAP
  PPAGAMIPPPPSLPGPPRPGMMPAPHMGGPPMMPMMGPPPPGMMPVGPAPGMRPPMGGHMPMMPGPPMMR
  PPARPMMVPTRPGMTRPDR
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 17.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_003084
• Locus ID: 6631
• UniProt ID: P09234, Q5TAL4
• Cytogenetics: 6p21.31
• Refseq Size: 733
• Refseq ORF: 477
• Synonyms: U1C; Yhc1
• Summary: This gene encodes one of the specific protein components of the U1 small nuclear ribonucleoprotein (snRNP) particle required for the formation of the spliceosome. The encoded protein participates in the processing of nuclear precursor messenger RNA splicing. snRNP particles are attacked by autoantibodies frequently produced by patients with connective tissue diseases. The genome contains several pseudogenes of this functional gene. Alternative splicing results in a non-coding transcript variant.[provided by RefSeq, Oct 2009]
• Protein Families: Stem cell - Pluripotency
• Protein Pathways: Spliceosome