BAF53A (ACTL6A) (NM_004301) Human Recombinant Protein

CAT#: TP317977

Recombinant protein of human actin-like 6A (ACTL6A), transcript variant 1, 20 µg

Product Images

Coomassie blue staining of purified ACTL6A protein (Cat# TP317977). The protein was produced from HEK293T cells transfected with ACTL6A cDNA clone (Cat# RC217977) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC217977 representing NM_004301
  Red=Cloning site Green=Tags(s)
  
  MVVERDDGSTLMEIDGDKGKQGGPTYYIDTNALRVPRENMEAISPLKNGMVEDWDSFQAILDHTYKMHVK
  SEASLHPVLMSEAPWNTRAKREKLTELMFEHYNIPAFFLCKTAVLTAFANGRSTGLILDSGATHTTAIPV
  HDGYVLQQGIVKSPLAGDFITMQCRELFQEMNIELVPPYMIATKEAVREGSPANWKRKEKLPQVTRSWHN
  YMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERLKIPEGLFDPSNVKGLSGNTM
  LGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGNTLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFS
  SWIGGSILASLGTFQQMWISKQEYEEGGKQCVERKCP
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 47.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_004292
• Locus ID: 86
• UniProt ID: O96019
• Cytogenetics: 3q26.33
• Refseq Size: 1879
• Refseq ORF: 1161
• Synonyms: ACTL6; Arp4; ARPN-BETA; BAF53A; INO80K
• Summary: This gene encodes a family member of actin-related proteins (ARPs), which share significant amino acid sequence identity to conventional actins. Both actins and ARPs have an actin fold, which is an ATP-binding cleft, as a common feature. The ARPs are involved in diverse cellular processes, including vesicular transport, spindle orientation, nuclear migration and chromatin remodeling. This gene encodes a 53 kDa subunit protein of the BAF (BRG1/brm-associated factor) complex in mammals, which is functionally related to SWI/SNF complex in S. cerevisiae and Drosophila; the latter is thought to facilitate transcriptional activation of specific genes by antagonizing chromatin-mediated transcriptional repression. Together with beta-actin, it is required for maximal ATPase activity of BRG1, and for the association of the BAF complex with chromatin/matrix. Three transcript variants that encode two different protein isoforms have been described. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Transcription Factors