CD200 (NM_001004196) Human Recombinant Protein

CAT#: TP317941

Purified recombinant protein of Homo sapiens CD200 molecule (CD200), transcript variant 2, 20 µg

Product Images

Coomassie blue staining of purified CD200 protein (Cat# TP317941). The protein was produced from HEK293T cells transfected with CD200 cDNA clone (Cat# RC217941) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC217941 representing NM_001004196
  Red=Cloning site Green=Tags(s)
  
  MERLTLTRTIGGPLLTATLLGKTTINDYQVIRMPFCHLSTYSLVWVMAAVVLCTAQVQVVTQDEREQLYT
  PASLKCSLQNAQEALIVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQLGLQNSTITFWNITLED
  EGCYMCLFNTFGFGKISGTACLTVYVQPIVSLHYKFSEDHLNITCSATARPAPMVFWKVPRSGIENSTVT
  LSHPNGTTSVTSILHIKDPKNQVGKEVICQVLHLGTVTDFKQTVNKGYWFSVPLLLSIVSLVILLVLISI
  LLYWKRHRNQDREP
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 32.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001004196
• Locus ID: 4345
• UniProt ID: P41217
• Cytogenetics: 3q13.2
• Refseq Size: 2247
• Refseq ORF: 882
• Synonyms: MOX1; MOX2; MRC; OX-2
• Summary: This gene encodes a type I membrane glycoprotein containing two extracellular immunoglobulin domains, a transmembrane and a cytoplasmic domain. This gene is expressed by various cell types, including B cells, a subset of T cells, thymocytes, endothelial cells, and neurons. The encoded protein plays an important role in immunosuppression and regulation of anti-tumor activity. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jan 2016]
• Protein Families: Transmembrane