SDS (NM_006843) Human Recombinant Protein

CAT#: TP317814

Recombinant protein of human serine dehydratase (SDS), 20 µg

Product Images

Coomassie blue staining of purified SDS protein (Cat# TP317814). The protein was produced from HEK293T cells transfected with SDS cDNA clone (Cat# RC217814) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC217814 representing NM_006843
  Red=Cloning site Green=Tags(s)
  
  MMSGEPLHVKTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQGCAHFVCSSAGNAGM
  AAAYAARQLGVPATIVVPSTTPALTIERLKNEGATVKVVGELLDEAFELAKALAKNNPGWVYIPPFDDPL
  IWEGHASIVKELKETLWEKPGAIALSVGGGGLLCGVVQGLQEVGWGDVPVIAMETFGAHSFHAATTAGKL
  VSLPKITSVAKALGVKTVGAQALKLFQEHPIFSEVISDQEAVAAIEKFVDDEKILVEPACGAALAAVYSH
  VIQKLQLEGNLRTPLPSLVVIVCGGSNISLAQLRALKEQLGMTNRLPK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 34.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_006834
• Locus ID: 10993
• UniProt ID: P20132, Q8WW81
• Cytogenetics: 12q24.13
• Refseq Size: 1620
• Refseq ORF: 984
• Synonyms: SDH
• Summary: This gene encodes one of three enzymes that are involved in metabolizing serine and glycine. L-serine dehydratase converts L-serine to pyruvate and ammonia and requires pyridoxal phosphate as a cofactor. The encoded protein can also metabolize threonine to NH4+ and 2-ketobutyrate. The encoded protein is found predominantly in the liver. [provided by RefSeq, Jul 2008]
• Protein Pathways: Cysteine and methionine metabolism, Glycine, serine and threonine metabolism, Metabolic pathways