PPM1H (NM_020700) Human Recombinant Protein

CAT#: TP317548L

Recombinant protein of human protein phosphatase 1H (PP2C domain containing) (PPM1H), 1 mg

Product Images

Release of free phosphate was measured after incubation of different protein phosphatases, including PPM1H (OriGene TP317548), with the generic phosphopeptide, RRA (pT)VA. * p < 0.01. Figure cited from PLoS ONE, PMID: 25658463

• 

  Coomassie blue staining of purified PPM1H protein (Cat# TP317548). The protein was produced from HEK293T cells transfected with PPM1H cDNA clone (Cat# RC217548) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC217548 representing NM_020700
  Red=Cloning site Green=Tags(s)
  
  MLTRVKSAVANFMGGIMAGSSGSEHGGGSCGGSDLPLRFPYGRPEFLGLSQDEVECSADHIARPILILKE
  TRRLPWATGYAEVINAGKSTHNEDQASCEVLTVKKKAGAVTSTPNRNSSKRRSSLPNGEGLQLKENSESE
  GVSCHYWSLFDGHAGSGAAVVASRLLQHHITEQLQDIVDILKNSAVLPPTCLGEEPENTPANSRTLTRAA
  SLRGGVGAPGSPSTPPTRFFTEKKIPHECLVIGALESAFKEMDLQIERERSSYNISGGCTALIVICLLGK
  LYVANAGDSRAIIIRNGEIIPMSSEFTPETERQRLQYLAFMQPHLLGNEFTHLEFPRRVQRKELGKKMLY
  RDFNMTGWAYKTIEDEDLKFPLIYGEGKKARVMATIGVTRGLGDHDLKVHDSNIYIKPFLSSAPEVRIYD
  LSKYDHGSDDVLILATDGLWDVLSNEEVAEAITQFLPNCDPDDPHRYTLAAQDLVMRARGVLKDRGWRIS
  NDRLGSGDDISVYVIPLIHGNKLS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 56.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Bioactivity: In vitro phosphatase assay (PMID: 25658463)
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_065751
• Locus ID: 57460
• UniProt ID: Q9ULR3
• Cytogenetics: 12q14.1-q14.2
• Refseq Size: 6201
• Refseq ORF: 1542
• Synonyms: ARHCL1; NERPP-2C; URCC2
• Summary: Dephosphorylates CDKN1B at 'Thr-187', thus removing a signal for proteasomal degradation.[UniProtKB/Swiss-Prot Function]
• Protein Families: Phosphatase