TOMM20L (NM_207377) Human Recombinant Protein
CAT#: TP317329
Recombinant protein of human translocase of outer mitochondrial membrane 20 homolog (yeast)-like (TOMM20L), nuclear gene encoding mitochondrial protein, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC217329 representing NM_207377
Red=Cloning site Green=Tags(s) MPSVRSLLRLLAAAAACGAFAFLGYCIYLNRKRRGDPAFKRRLRDKRRAEPQKAEEQGTQLWDPTKNKKL QELFLQEVRMGELWLSRGEHRMGIQHLGNALLVCEQPRELLKVFKHTLPPKVFEMLLHKIPLICQQFEAD MNEQDCLEDDPD SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 17.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_997260 |
Locus ID | 387990 |
UniProt ID | Q6UXN7 |
Cytogenetics | 14q23.1 |
Refseq Size | 622 |
Refseq ORF | 456 |
Synonyms | UNQ9438 |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403994 | TOMM20L HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY403994 | Transient overexpression lysate of translocase of outer mitochondrial membrane 20 homolog (yeast)-like (TOMM20L), nuclear gene encoding mitochondrial protein |
USD 436.00 |
|
PH317329 | TOMM20L MS Standard C13 and N15-labeled recombinant protein (NP_997260) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review