FAM108B1 (ABHD17B) (NM_016014) Human Recombinant Protein

CAT#: TP317164

Recombinant protein of human family with sequence similarity 108, member B1 (FAM108B1), transcript variant 1, 20 µg

Product Images

Coomassie blue staining of purified ABHD17B protein (Cat# TP317164). The protein was produced from HEK293T cells transfected with ABHD17B cDNA clone (Cat# RC217164) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC217164 representing NM_016014
  Red=Cloning site Green=Tags(s)
  
  MNNLSFSELCCLFCCPPCPGKIASKLAFLPPDPTYTLMCDESGSRWTLHLSERADWQYSSREKDAIECFM
  TRTSKGNRIACMFVRCSPNAKYTLLFSHGNAVDLGQMSSFYIGLGSRINCNIFSYDYSGYGASSGKPTEK
  NLYADIEAAWLALRTRYGIRPENVIIYGQSIGTVPSVDLAARYESAAVILHSPLTSGMRVAFPDTKKTYC
  FDAFPNIDKISKITSPVLIIHGTEDEVIDFSHGLALFERCQRPVEPLWVEGAGHNDVELYGQYLERLKQF
  VSQELVQKHKEGK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 32.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_057098
• Locus ID: 51104
• UniProt ID: Q5VST6
• Cytogenetics: 9q21.13
• Refseq Size: 1614
• Refseq ORF: 879
• Synonyms: C9orf77; CGI-67; FAM108B1
• Summary: Hydrolyzes fatty acids from S-acylated cysteine residues in proteins (PubMed:26701913). Has depalmitoylating activity towards DLG4/PSD95 (PubMed:26701913). Has depalmitoylating activity towards GAP43 (By similarity). Has depalmitoylating activity towards MAP6 (By similarity). Has depalmitoylating activity towards NRAS (PubMed:26701913).[UniProtKB/Swiss-Prot Function]
• Protein Families: Protease