PMPCA (NM_015160) Human Recombinant Protein

CAT#: TP317017M

Recombinant protein of human peptidase (mitochondrial processing) alpha (PMPCA), nuclear gene encoding mitochondrial protein, 100 µg

Product Images

Coomassie blue staining of purified PMPCA protein (Cat# TP317017). The protein was produced from HEK293T cells transfected with PMPCA cDNA clone (Cat# RC217017) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC217017 representing NM_015160
  Red=Cloning site Green=Tags(s)
  
  MAAVVLAATRLLRGSGSWGCSRLRFGPPAYRRFSSGGAYPNIPLSSPLPGVPKPVFATVDGQEKFETKVT
  TLDNGLRVASQNKFGQFCTVGILINSGSRYEAKYLSGIAHFLEKLAFSSTARFDSKDEILLTLEKHGGIC
  YCQTSRDTTMYAVSADSKGLDTVVALLADVVLQPRLTDEEVEMTRMAVQFELEDLNLRPDPEPLLTEMIH
  EAAYRENTVGLHRFCPTENVAKINREVLHSYLRNYYTPDRMVLAGVGVEHEHLVDCARKYLLGVQPAWGS
  AEAVDIDRSVAQYTGGIAKLERDMSNVSLGPTPIPELTHIMVGLESCSFLEEDFIPFAVLNMMMGGGGSF
  SAGGPGKGMFSRLYLNVLNRHHWMYNATSYHHSYEDTGLLCIHASADPRQVREMVEIITKEFILMGGTVD
  TVELERAKTQLTSMLMMNLESRPVIFEDVGRQVLATRSRKLPHELCTLIRNVKPEDVKRVASKMLRGKPA
  VAALGDLTDLPTYEHIQTALSSKDGRLPRTYRLFR
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 58.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_055975
• Locus ID: 23203
• UniProt ID: Q10713
• Cytogenetics: 9q34.3
• Refseq Size: 2097
• Refseq ORF: 1575
• Synonyms: Alpha-MPP; CLA1; CPD3; INPP5E; MAS2; P-55; SCAR2
• Summary: The protein encoded by this gene is found in the mitochondrion, where it represents the alpha subunit of a proteolytic heterodimer. This heterodimer is responsible for cleaving the transit peptide from nuclear-encoded mitochondrial proteins. Defects in this gene are a cause of spinocerebellar ataxia, autosomal recessive 2. [provided by RefSeq, Mar 2016]
• Protein Families: Druggable Genome, Protease