ZNF706 (NM_001042510) Human Recombinant Protein
CAT#: TP316962
Recombinant protein of human zinc finger protein 706 (ZNF706), transcript variant 1, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC216962 protein sequence
Red=Cloning site Green=Tags(s) MARGQQKIQSQQKNAKKQAGQKKKQGHDQKAAAKAALIYTCTVCRTQMPDPKTFKQHFESKHPKTPLPPE LADVQA SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 8.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001035975 |
Locus ID | 51123 |
UniProt ID | Q9Y5V0 |
Cytogenetics | 8q22.3 |
Refseq Size | 2870 |
Refseq ORF | 228 |
Synonyms | HSPC038; PNAS-106; PNAS-113 |
Summary | Transcription repressor involved in the exit of embryonic stem cells (ESCs) from self-renewal. Acts by repressing expression of KLF4.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414186 | ZNF706 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC420950 | ZNF706 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC420951 | ZNF706 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY414186 | Transient overexpression lysate of zinc finger protein 706 (ZNF706), transcript variant 2 |
USD 436.00 |
|
LY420950 | Transient overexpression lysate of zinc finger protein 706 (ZNF706), transcript variant 1 |
USD 436.00 |
|
LY420951 | Transient overexpression lysate of zinc finger protein 706 (ZNF706), transcript variant 3 |
USD 436.00 |
|
PH309807 | ZNF706 MS Standard C13 and N15-labeled recombinant protein (NP_057180) |
USD 3,255.00 |
|
PH316962 | ZNF706 MS Standard C13 and N15-labeled recombinant protein (NP_001035975) |
USD 3,255.00 |
|
PH320360 | ZNF706 MS Standard C13 and N15-labeled recombinant protein (NP_001035976) |
USD 3,255.00 |
|
TP309807 | Recombinant protein of human zinc finger protein 706 (ZNF706), transcript variant 2, 20 µg |
USD 867.00 |
|
TP320360 | Recombinant protein of human zinc finger protein 706 (ZNF706), transcript variant 3, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review