RAB6B (NM_016577) Human Recombinant Protein

CAT#: TP316303

Recombinant protein of human RAB6B, member RAS oncogene family (RAB6B), 20 µg

Product Images

Coomassie blue staining of purified RAB6B protein (Cat# TP316303). The protein was produced from HEK293T cells transfected with RAB6B cDNA clone (Cat# RC216303) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC216303 representing NM_016577
  Red=Cloning site Green=Tags(s)
  
  MSAGGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTA
  GQERFRSLIPSYIRDSTVAVVVYDITNLNSFQQTSKWIDDVRTERGSDVIIMLVGNKTDLADKRQITIEE
  GEQRAKELSVMFIETSAKTGYNVKQLFRRVASALPGMENVQEKSKEGMIDIKLDKPQEPPASEGGCSC
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 23.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_057661
• Locus ID: 51560
• UniProt ID: Q9NRW1
• Cytogenetics: 3q22.1
• Refseq Size: 5561
• Refseq ORF: 624
• Summary: Seems to have a role in retrograde membrane traffic at the level of the Golgi complex. May function in retrograde transport in neuronal cells.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome