Syntenin (SDCBP) (NM_001007068) Human Recombinant Protein
CAT#: TP315442
Purified recombinant protein of Homo sapiens syndecan binding protein (syntenin) (SDCBP), transcript variant 3, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC215442 representing NM_001007068
Red=Cloning site Green=Tags(s) MSLYPSLEDLKAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGA PLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSP ASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNG KITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAFIFEHIIKRMAPSI MKSLMDHTIPEV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 31.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001007069 |
Locus ID | 6386 |
UniProt ID | O00560 |
Cytogenetics | 8q12.1 |
Refseq Size | 2155 |
Refseq ORF | 876 |
Synonyms | MDA-9; MDA9; ST1; SYCL; TACIP18 |
Summary | The protein encoded by this gene was initially identified as a molecule linking syndecan-mediated signaling to the cytoskeleton. The syntenin protein contains tandemly repeated PDZ domains that bind the cytoplasmic, C-terminal domains of a variety of transmembrane proteins. This protein may also affect cytoskeletal-membrane organization, cell adhesion, protein trafficking, and the activation of transcription factors. The protein is primarily localized to membrane-associated adherens junctions and focal adhesions but is also found at the endoplasmic reticulum and nucleus. Alternative splicing results in multiple transcript variants encoding different isoforms. Related pseudogenes have been identified on multiple chromosomes. [provided by RefSeq, Jan 2017] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417182 | SDCBP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC423571 | SDCBP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC423572 | SDCBP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC425198 | SDCBP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY417182 | Transient overexpression lysate of syndecan binding protein (syntenin) (SDCBP), transcript variant 1 |
USD 436.00 |
|
LY423571 | Transient overexpression lysate of syndecan binding protein (syntenin) (SDCBP), transcript variant 2 |
USD 436.00 |
|
LY423572 | Transient overexpression lysate of syndecan binding protein (syntenin) (SDCBP), transcript variant 3 |
USD 436.00 |
|
LY425198 | Transient overexpression lysate of syndecan binding protein (syntenin) (SDCBP), transcript variant 2 |
USD 436.00 |
|
PH312681 | SDCBP MS Standard C13 and N15-labeled recombinant protein (NP_001007068) |
USD 3,255.00 |
|
PH315390 | SDCBP MS Standard C13 and N15-labeled recombinant protein (NP_005616) |
USD 3,255.00 |
|
PH315442 | SDCBP MS Standard C13 and N15-labeled recombinant protein (NP_001007069) |
USD 3,255.00 |
|
TP312681 | Purified recombinant protein of Homo sapiens syndecan binding protein (syntenin) (SDCBP), transcript variant 2, 20 µg |
USD 867.00 |
|
TP315390 | Recombinant protein of human syndecan binding protein (syntenin) (SDCBP), transcript variant 1, 20 µg |
USD 867.00 |
|
TP720983 | Purified recombinant protein of Human syndecan binding protein (syntenin) (SDCBP), transcript variant 5 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review