GOSR1 (NM_001007024) Human Recombinant Protein

CAT#: TP314955L

Recombinant protein of human golgi SNAP receptor complex member 1 (GOSR1), transcript variant 3, 1 mg

Product Images

Coomassie blue staining of purified GOSR1 protein (Cat# TP314955). The protein was produced from HEK293T cells transfected with GOSR1 cDNA clone (Cat# RC214955) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC214955 representing NM_001007024
  Red=Cloning site Green=Tags(s)
  
  MAAGTSSYWEDLRKQARQLENELDLKLVSFSKLCTSYSHSSTRDGRRDRYSSDTTPLLNGSSQDRMFETM
  AIEIEQLLARLTGVNDKMAEYTNSAGVPSLNAALMHTLQRHRDILQDYTHEFHKTKANFMAIRERENLMG
  SVRKDIESYKSGSGVNNRRTELFLKEHDHLRNSDRLIEETISIAMATKENMTSQRGMLKSIHSKMNTLAN
  RFPAVNSLIQRINLRKRRDSLILGGVIGICTILLLLYAFH
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 21 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001007025
• Locus ID: 9527
• UniProt ID: O95249
• Cytogenetics: 17q11.2
• Refseq Size: 5246
• Refseq ORF: 750
• Synonyms: GOLIM2; GOS-28; GOS28; GOS28/P28; GS28; P28
• Summary: This gene encodes a trafficking membrane protein which transports proteins among the endoplasmic reticulum and the Golgi and between Golgi compartments. This protein is considered an essential component of the Golgi SNAP receptor (SNARE) complex. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: SNARE interactions in vesicular transport