HMGA2 (NM_003484) Human Recombinant Protein

CAT#: TP314681

Recombinant protein of human high mobility group AT-hook 2 (HMGA2), transcript variant 2, 20 µg

Product Images

Coomassie blue staining of purified HMGA2 protein (Cat# TP314681). The protein was produced from HEK293T cells transfected with HMGA2 cDNA clone (Cat# RC214681) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC214681 representing NM_003484
  Red=Cloning site Green=Tags(s)
  
  MSARGEGAGQPSTSAQGQPAAPAPQKRGRGRPRKQQQEPTGEPSPKRPRGRPKGSKNKSPSKAAQKKAEA
  TGEKRPRGRPRKWDNLLPRTSSKKKTSLGNSTKRSH
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 11.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_003475
• Locus ID: 8091
• UniProt ID: P52926
• Cytogenetics: 12q14.3
• Refseq Size: 1539
• Refseq ORF: 318
• Synonyms: BABL; HMGI-C; HMGIC; LIPO; SRS5; STQTL9
• Summary: This gene encodes a protein that belongs to the non-histone chromosomal high mobility group (HMG) protein family. HMG proteins function as architectural factors and are essential components of the enhancesome. This protein contains structural DNA-binding domains and may act as a transcriptional regulating factor. Identification of the deletion, amplification, and rearrangement of this gene that are associated with myxoid liposarcoma suggests a role in adipogenesis and mesenchymal differentiation. A gene knock out study of the mouse counterpart demonstrated that this gene is involved in diet-induced obesity. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome