ENTPD4 (NM_004901) Human Recombinant Protein
CAT#: TP314422
Recombinant protein of human ectonucleoside triphosphate diphosphohydrolase 4 (ENTPD4), transcript variant 1, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC214422 representing NM_004901
Red=Cloning site Green=Tags(s) MGRIGISCLFPASWHFSISPVGCPRILNTNLRQIMVISVLAAAVSLLYFSVVIIRNKYGRLTRDKKFQRY LARVTDIEATDTNNPNVNYGIVVDCGSSGSRVFVYCWPRHNGNPHDLLDIRQMRDKNRKPVVMKIKPGIS EFATSPEKVSDYISPLLNFAAEHVPRAKHKETPLYILCTAGMRILPESQQKAILEDLLTDIPVHFDFLFS DSHAEVISGKQEGVYAWIGINFVLGRFEHIEDDDEAVVEVNIPGSESSEAIVRKRTAGILDMGGVSTQIA YEVPKTVSFASSQQEEVAKNLLAEFNLGCDVHQTEHVYRVYVATFLGFGGNAARQRYEDRIFANTIQKNR LLGKQTGLTPDMPYLDPCLPLDIKDEIQQNGQTIYLRGTGDFDLCRETIQPFMNKTNETQTSLNGVYQPP IHFQNSEFYGFSEFYYCTEDVLRMGGDYNAAKFTKAAKDYCATKWSILRERFDRGLYASHADLHRLKYQC FKSAWMFEVFHRGFSFPVNYKSLKTALQVYDKEVQWTLGAILYRTRFLPLRDIQQEAFRASHTHWRGVSF VYNHYLFSGCFLVVLLAILLYLLRLRRIHRRTPRSSSAAALWMEEGLPAQNAPGTL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 70.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004892 |
Locus ID | 9583 |
UniProt ID | Q9Y227 |
Cytogenetics | 8p21.3 |
Refseq Size | 2330 |
Refseq ORF | 1848 |
Synonyms | LALP70; LAP70; LYSAL1; NTPDase-4; UDPase |
Summary | This gene encodes a member of the apyrase protein family. Apyrases are enzymes that catalyze the hydrolysis of nucleotide diphosphates and triphosphates in a calcium or magnesium-dependent manner. The encoded protein is an endo-apyrase and may play a role in salvaging nucleotides from lysosomes. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and these isoforms may differ in divalent cation dependence and substrate specificity. [provided by RefSeq, Sep 2011] |
Protein Families | Transmembrane |
Protein Pathways | Lysosome, Purine metabolism, Pyrimidine metabolism |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417671 | ENTPD4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC427031 | ENTPD4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY417671 | Transient overexpression lysate of ectonucleoside triphosphate diphosphohydrolase 4 (ENTPD4), transcript variant 1 |
USD 665.00 |
|
LY427031 | Transient overexpression lysate of ectonucleoside triphosphate diphosphohydrolase 4 (ENTPD4), transcript variant 2 |
USD 436.00 |
|
PH314422 | ENTPD4 MS Standard C13 and N15-labeled recombinant protein (NP_004892) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review