Aminomethyltransferase (AMT) (NM_000481) Human Recombinant Protein
CAT#: TP314343
Recombinant protein of human aminomethyltransferase (AMT), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC214343 representing NM_000481
Red=Cloning site Green=Tags(s) MQRAVSVVARLGFRLQAFPPALCRPLSCAQEVLRRTPLYDFHLAHGGKMVAFAGWSLPVQYRDSHTDSHL HTRQHCSLFDVSHMLQTKILGSDRVKLMESLVVGDIAELRPNQGTLSLFTNEAGGILDDLIVTNTSEGHL YVVSNAGCWEKDLALMQDKVRELQNQGRDVGLEVLDNALLALQGPTAAQVLQAGVADDLRKLPFMTSAVM EVFGVSGCRVTRCGYTGEDGVEISVPVAGAVHLATAILKNPEVKLAGLAARDSLRLEAGLCLYGNDIDEH TTPVEGSLSWTLGKRRRAAMDFPGAKVIVPQLKGRVQRRRVGLMCEGAPMRAHSPILNMEGTKIGTVTSG CPSPSLKKNVAMGYVPCEYSRPGTMLLVEVRRKQQMAVVSKMPFVPTNYYTLK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 43.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000472 |
Locus ID | 275 |
UniProt ID | P48728, A0A024R2U7 |
Cytogenetics | 3p21.31 |
Refseq Size | 2117 |
Refseq ORF | 1209 |
Synonyms | GCE; GCST; GCVT; NKH |
Summary | This gene encodes one of four critical components of the glycine cleavage system. Mutations in this gene have been associated with glycine encephalopathy. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2011] |
Protein Pathways | Glycine, serine and threonine metabolism, Metabolic pathways, Nitrogen metabolism, One carbon pool by folate |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424691 | AMT HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC431304 | AMT HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC431317 | AMT HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC431336 | AMT HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY424691 | Transient overexpression lysate of aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 1 |
USD 436.00 |
|
LY431304 | Transient overexpression lysate of aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 3 |
USD 436.00 |
|
LY431317 | Transient overexpression lysate of aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 2 |
USD 436.00 |
|
LY431336 | Transient overexpression lysate of aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 4 |
USD 436.00 |
|
PH314343 | AMT MS Standard C13 and N15-labeled recombinant protein (NP_000472) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review