Sarcalumenin (SRL) (NM_001098814) Human Recombinant Protein

CAT#: TP314041L

Recombinant protein of human sarcalumenin (SRL), 1 mg

Product Images

Coomassie blue staining of purified SRL protein (Cat# TP314041). The protein was produced from HEK293T cells transfected with SRL cDNA clone (Cat# RC214041) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC214041 representing NM_001098814
  Red=Cloning site Green=Tags(s)
  
  MRALVLLGCLLASLLFSGQAEETEDANEEAPLRDRSHIEKTLMLNEDKPSDDYSAVLQRLRKIYHSSIKP
  LEQSYKYNELRQHEITDGEITSKPMVLFLGPWSVGKSTMINYLLGLENTRYQLYTGAEPTTSEFTVLMHG
  PKLKTIEGIVMAADSARSFSPLEKFGQNFLEKLIGIEVPHKLLERVTFVDTPGIIENRKQQERGYPFNDV
  CQWFIDRADLIFVVFDPTKLDVGLELEMLFRQLKGRESQIRIILNKADNLATQMLMRVYGALFWSLAPLI
  NVTEPPRVYVSSFWPQEYKPDTHQELFLQEEISLLEDLNQVIENRLENKIAFIRQHAIRVRIHALLVDRY
  LQTYKDKMTFFSDGELVFKDIVEDPDKFYIFKTILAKTNVSKFDLPNREAYKDFFGINPISSFKLLSQQC
  SYMGGCFLEKIERAITQELPGLLGSLGLGKNPGALNCDKTGCSETPKNRYRKH
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 54.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001092284
• Locus ID: 6345
• UniProt ID: Q86TD4, B3KPP4, Q86TD4-2
• Cytogenetics: 16p13.3
• Refseq Size: 4219
• Refseq ORF: 1419
• Synonyms: SAR
• Summary: May be involved in the regulation of calcium transport.[UniProtKB/Swiss-Prot Function]