SNAI3 (NM_178310) Human Recombinant Protein

CAT#: TP313897

Recombinant protein of human snail homolog 3 (Drosophila) (SNAI3), 20 µg

Product Images

Coomassie blue staining of purified SNAI3 protein (Cat# TP313897). The protein was produced from HEK293T cells transfected with SNAI3 cDNA clone (Cat# RC213897) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC213897 representing NM_178310
  Red=Cloning site Green=Tags(s)
  
  MPRSFLVKTHSSHRVPNYRRLETQREINGACSACGGLVVPLLPRDKEAPSVPGDLPQPWDRSSAVACISL
  PLLPRIEEALGASGLDALEVSEVDPRASRAAIVPLKDSLNHLNLPPLLVLPTRWSPTLGPDRHGAPEKLL
  GAERMPRAPGGFECFHCHKPYHTLAGLARHRQLHCHLQVGRVFTCKYCDKEYTSLGALKMHIRTHTLPCT
  CKICGKAFSRPWLLQGHVRTHTGEKPYACSHCSRAFADRSNLRAHLQTHSDAKKYRCRRCTKTFSRMSLL
  ARHEESGCCPGP
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 32.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_840101
• Locus ID: 333929
• UniProt ID: Q3KNW1
• Cytogenetics: 16q24.2
• Refseq Size: 1630
• Refseq ORF: 876
• Synonyms: SMUC; SNAIL3; Zfp293; ZNF293
• Summary: SNAI3 is a member of the SNAIL gene family, named for the Drosophila snail gene, which plays roles in mesodermal formation during embryogenesis (Katoh and Katoh, 2003 [PubMed 12579345]).[supplied by OMIM, Apr 2009]