DCL 1 (CD302) (NM_014880) Human Recombinant Protein

CAT#: TP313785L

Recombinant protein of human CD302 molecule (CD302), 1 mg

Product Images

Coomassie blue staining of purified CD302 protein (Cat# TP313785). The protein was produced from HEK293T cells transfected with CD302 cDNA clone (Cat# RC213785) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC213785 representing NM_014880
  Red=Cloning site Green=Tags(s)
  
  MLRAALPALLLPLLGLAAAAVADCPSSTWIQFQDSCYIFLQEAIKVESIEDVRNQCTDHGADMISIHNEE
  ENAFILDTLKKQWKGPDDILLGMFYDTDDASFKWFDNSNMTFDKWTDQDDDEDLVDTCAFLHIKTGEWKK
  GNCEVSSVEGTLCKTAIPYKRKYLSDNHILISALVIASTVILTVLGAIIWFLYKKHSDSRFTTVFSTAPQ
  SPYNEDCVLVVGEENEYPVQFD
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 26 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_055695
• Locus ID: 9936
• UniProt ID: Q8IX05
• Cytogenetics: 2q24.2
• Refseq Size: 3740
• Refseq ORF: 696
• Synonyms: BIMLEC; CLEC13A; DCL-1; DCL1
• Summary: CD302 is a C-type lectin receptor involved in cell adhesion and migration, as well as endocytosis and phagocytosis (Kato et al., 2007 [PubMed 17947679]).[supplied by OMIM, Aug 2008]
• Protein Families: Druggable Genome, Transmembrane