HENMT1 (NM_001102592) Human Recombinant Protein

CAT#: TP312823L

Purified recombinant protein of Homo sapiens chromosome 1 open reading frame 59 (C1orf59), transcript variant 2, 1 mg

Product Images

Coomassie blue staining of purified HENMT1 protein (Cat# TP312823). The protein was produced from HEK293T cells transfected with HENMT1 cDNA clone (Cat# RC212823) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC212823 representing NM_001102592
  Red=Cloning site Green=Tags(s)
  
  MEENNLQCSSVVDGNFEEVPRETAIQFKPPLYRQRYQFVKNLVDQHEPKKVADLGCGDTSLLRLLKVNPC
  IELLVGVDINEDKLRWRGDSLAPFLGDFLKPRDLNLTITLYHGSVVERDSRLLGFDLITCIELIEHLDSG
  DLARFPEVVFGYLSPSMIVISTPNSEFNPLFPSVTLRDSDHKFEWTRMEFQTWALYVANRYDYSVEFTGV
  GEPPAGAENVGYCTQIGIFRKNGGKATESCLSEQHDQHVYKAVFTTSYPSLQQERFFKLVLVNEVSQQVE
  SLRVSHLPRRKEQAGERGDKPKDIGGSKAPVPCFGPVFTEVEKAKIENSPTPFCVGDKFFVPLQRLLAYP
  KLNRLCANEEMMRSVIADSIPLSSDGSAVVADLRNYFDEQFEF
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 44.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001096062
• Locus ID: 113802
• UniProt ID: Q5T8I9
• Cytogenetics: 1p13.3
• Refseq Size: 1707
• Refseq ORF: 1179
• Synonyms: C1orf59; HEN1
• Summary: Methyltransferase that adds a 2'-O-methyl group at the 3'-end of piRNAs, a class of 24 to 30 nucleotide RNAs that are generated by a Dicer-independent mechanism and are primarily derived from transposons and other repeated sequence elements. This probably protects the 3'-end of piRNAs from uridylation activity and subsequent degradation. Stabilization of piRNAs is essential for gametogenesis.[UniProtKB/Swiss-Prot Function]