IL19 (NM_013371) Human Recombinant Protein
CAT#: TP312571
Recombinant protein of human interleukin 19 (IL19), transcript variant 2, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC212571 representing NM_013371
Red=Cloning site Green=Tags(s) MKLQCVSLWLLGTILILCSVDNHGLRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIK PLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVI HDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMFSA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 17.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_037503 |
Locus ID | 29949 |
UniProt ID | Q9UHD0, Q5VUT3 |
Cytogenetics | 1q32.1 |
Refseq Size | 1831 |
Refseq ORF | 531 |
Synonyms | IL-10C; MDA1; NG.1; ZMDA1 |
Summary | The protein encoded by this gene is a cytokine that belongs to the IL10 cytokine subfamily. This cytokine is found to be preferentially expressed in monocytes. It can bind the IL20 receptor complex and lead to the activation of the signal transducer and activator of transcription 3 (STAT3). A similar cytokine in mouse is reported to up-regulate the expression of IL6 and TNF-alpha and induce apoptosis, which suggests a role of this cytokine in inflammatory responses. Alternatively spliced transcript variants encoding the distinct isoforms have been described. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415631 | IL19 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY415631 | Transient overexpression lysate of interleukin 19 (IL19), transcript variant 2 |
USD 436.00 |
|
PH312571 | IL19 MS Standard C13 and N15-labeled recombinant protein (NP_037503) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review