SERINC3 (NM_006811) Human Recombinant Protein

CAT#: TP312480

Recombinant protein of human serine incorporator 3 (SERINC3), transcript variant 1, 20 µg

Product Images

Coomassie blue staining of purified SERINC3 protein (Cat# TP312480). The protein was produced from HEK293T cells transfected with SERINC3 cDNA clone (Cat# RC212480) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC212480 representing NM_006811
  Red=Cloning site Green=Tags(s)
  
  MGAVLGVFSLASWVPCLCSGASCLLCSCCPNSKNSTVTRLIYAFILLLSTVVSYIMQRKEMETYLKKIPG
  FCEGGFKIHEADINADKDCDVLVGYKAVYRISFAMAIFFFVFSLLMFKVKTSKDLRAAVHNGFWFFKIAA
  LIGIMVGSFYIPGGYFSSVWFVVGMIGAALFILIQLVLLVDFAHSWNESWVNRMEEGNPRLWYAALLSFT
  SAFYILSIICVGLLYTYYTKPDGCTENKFFISINLILCVVASIISIHPKIQEHQPRSGLLQSSLITLYTM
  YLTWSAMSNEPDRSCNPNLMSFITRITAPTLAPGNSTAVVPTPTPPSKSGSLLDSDNFIGLFVFVLCLLY
  SSIRTSTNSQVDKLTLSGSDSVILGDTTTSGASDEEDGQPRRAVDNEKEGVQYSYSLFHLMLCLASLYIM
  MTLTSWYSPDAKFQSMTSKWPAVWVKISSSWVCLLLYVWTLVAPLVLTSRDFS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 52.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_006802
• Locus ID: 10955
• UniProt ID: Q13530
• Cytogenetics: 20q13.12
• Refseq Size: 2592
• Refseq ORF: 1419
• Synonyms: AIGP1; DIFF33; SBBI99; TDE; TDE1; TMS-1
• Summary: Restriction factor required to restrict infectivity of lentiviruses, such as HIV-1: acts by inhibiting an early step of viral infection. Impairs the penetration of the viral particle into the cytoplasm (PubMed:26416733, PubMed:26416734).[UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane