AMELY (NM_001143) Human Recombinant Protein

CAT#: TP312029L

Recombinant protein of human amelogenin, Y-linked (AMELY), 1 mg

Product Images

Coomassie blue staining of purified AMELY protein (Cat# TP312029). The protein was produced from HEK293T cells transfected with AMELY cDNA clone (Cat# RC212029) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC212029 representing NM_001143
  Red=Cloning site Green=Tags(s)
  
  MGTWILFACLVGAAFAMPLPPHPGHPGYINFSYEVLTPLKWYQSMIRPPYSSYGYEPMGGWLHHQIIPVV
  SQQHPLTHTLQSHHHIPVVPAQQPRVRQQALMPVPGQQSMTPTQHHQPNLPLPAQQPFQPQPVQPQPHQP
  MQPQPPVQPMQPLLPQPPLPPMFPLRPLPPILPDLHLEAWPATDKTKQEEVD
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 20 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001134
• Locus ID: 266
• UniProt ID: Q99218
• Cytogenetics: Yp11.2
• Refseq Size: 802
• Refseq ORF: 576
• Synonyms: AMGL; AMGY
• Summary: This gene encodes a member of the amelogenin family of extracellular matrix proteins. Amelogenins are involved in biomineralization during tooth enamel development. Mutations in a related gene on chromosome X cause X-linked amelogenesis imperfecta. [provided by RefSeq, Jul 2008]
• Protein Families: Secreted Protein