OSBPL9 (NM_148909) Human Recombinant Protein
CAT#: TP311520
Recombinant protein of human oxysterol binding protein-like 9 (OSBPL9), transcript variant 7, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC211520 representing NM_148909
Red=Cloning site Green=Tags(s) MASIMEGPLSKWTNVMKGWQYRWFVLDYNAGLLSYYTSKDKMMRGSRRGCVRLRGAVIGIDDEDDSTFTI TVDQKTFHFQARDADEREKWIHALEETILRHTLQLQISTTLAFFQSSGISPVLEFSKIIGLDSGFVPSVQ DFDKKLTEADAYLQILIEQLKLFDDKLQNCKEDEQRKKIETLKETTNSMVESIKHCIVLLQIAKSTINPV DAIYQPSPLEPVISTMPSQTVLPPEPVQLCKSEQRPSSLPVGPVLATLGHHQTPTPNSTGSGHSPPSSSL TSPSHVNLSPNTVPEFSYSSSEDEFYDADEFHQSGSSPKRLIDSSGSASVLTHSSSGNSLKRPDTTESLN SSLSNGTSDADLFDSHDDRDDDAEAGSVEEHKSVIMHLLSQVRLGMDLTKVVLPTFILERRSLLEMYADF FAHPDLFVSISDQKDPKDRMVQVVKWYLSAFHAGRKGSVAKKPYNPILGEIFQCHWTLPNDTEENTELVS EGPVPWVSKNSVTFVAEQVSHHPPISAFYAECFNKKIQFNAHIWTKSKFLGMSIGVHNIGQGCVSCLDYD EHYILTFPNGYGRSILTVPWVELGGECNINCSKTGYSANIIFHTKPFYGGKKHRITAEIFSPNDKKSFCS IEGEWNGVMYAKYATGENTVFVDTKKLPIIKKKVRKLEDQNEYESRSLWKDVTFNLKIRDIDAATEAKHR LEERQRAEARERKEKEIQWETRLFHEDGECWVYDEPLLKRLGAAKH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 84.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_683707 |
Locus ID | 114883 |
UniProt ID | Q96SU4, Q8TAS8 |
Cytogenetics | 1p32.3 |
Refseq Size | 2949 |
Refseq ORF | 2238 |
Synonyms | ORP-9; ORP9 |
Summary | This gene encodes a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Most members contain an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain, although some members contain only the sterol-binding domain. This family member functions as a cholesterol transfer protein that regulates Golgi structure and function. Multiple transcript variants, most of which encode distinct isoforms, have been identified. Related pseudogenes have been identified on chromosomes 3, 11 and 12. [provided by RefSeq, Jul 2010] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407760 | OSBPL9 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC407761 | OSBPL9 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC407762 | OSBPL9 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC407763 | OSBPL9 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC407764 | OSBPL9 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC407765 | OSBPL9 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LY407760 | Transient overexpression lysate of oxysterol binding protein-like 9 (OSBPL9), transcript variant 1 |
USD 436.00 |
|
LY407761 | Transient overexpression lysate of oxysterol binding protein-like 9 (OSBPL9), transcript variant 2 |
USD 665.00 |
|
LY407762 | Transient overexpression lysate of oxysterol binding protein-like 9 (OSBPL9), transcript variant 3 |
USD 665.00 |
|
LY407763 | Transient overexpression lysate of oxysterol binding protein-like 9 (OSBPL9), transcript variant 4 |
USD 665.00 |
|
LY407764 | Transient overexpression lysate of oxysterol binding protein-like 9 (OSBPL9), transcript variant 5 |
USD 665.00 |
|
LY407765 | Transient overexpression lysate of oxysterol binding protein-like 9 (OSBPL9), transcript variant 7 |
USD 665.00 |
|
PH311520 | OSBPL9 MS Standard C13 and N15-labeled recombinant protein (NP_683707) |
USD 3,255.00 |
|
PH321053 | OSBPL9 MS Standard C13 and N15-labeled recombinant protein (NP_683706) |
USD 3,255.00 |
|
PH321526 | OSBPL9 MS Standard C13 and N15-labeled recombinant protein (NP_683705) |
USD 3,255.00 |
|
TP321053 | Recombinant protein of human oxysterol binding protein-like 9 (OSBPL9), transcript variant 5, 20 µg |
USD 867.00 |
|
TP321526 | Recombinant protein of human oxysterol binding protein-like 9 (OSBPL9), transcript variant 4, 20 µg |
USD 867.00 |
|
TP760439 | Purified recombinant protein of Human oxysterol binding protein-like 9 (OSBPL9), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
USD 261.00 |
|
TP760538 | Purified recombinant protein of Human oxysterol binding protein-like 9 (OSBPL9), transcript variant 1, with N-terminal HIS tag, expressed in E.Coli, 50ug |
USD 261.00 |
{0} Product Review(s)
Be the first one to submit a review